PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G24696.1
Common NameF27A10.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 375aa    MW: 42838 Da    PI: 9.5631
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G24696.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.12.1e-1553122373
                  EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT CS
           B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkang 73 
                   +l+++++lk++ l+lp ++++++g++k++ +++ l+d   rsWe+ l+++k+ +++ +t+GW++F+++ng
  AT2G24696.1  53 VALVKASNLKEDALYLPQDCTSSNGLNKKC-RKIFLTDGGDRSWEMDLKFDKNLDSFCITRGWRHFCDENG 122
                  578999*********************977.6*************************************97 PP

2B346.75.7e-15131216190
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                  f++v + +d l+++rl+l+++f++++g+   e+k++tl  ++g +   +l  r + gr+ l++GW +F+kan+Lk g+ ++++ ++++  
  AT2G24696.1 131 FVTVRLVPDCLRNKRLYLSRRFLKNNGLG--EPKMVTLVGTDGTRILANL-LRESTGRMSLGRGWVDFAKANRLKIGEYFTLESIWEN-D 216
                  6677778999*************999988..6779***************.6999999*************************88853.3 PP

3B3352.5e-11281372499
                  E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  +l+p+dv +  +l+lp +f++++g++k +  ++ +   +  +W        ++g +  + GW+ F+++ng+k g +++++ + + ++++v+k++ k
  AT2G24696.1 281 TLVPEDVKAG-MLRLPSHFMKANGIDKVG--KIYMLGINEMEWWWGDL-LTRDGIVSVGCGWRYFCESNGVKIGKSFTLECMYKYDTRPVFKFCPK 372
                  6788888876.5************99988..69999988877766652.666677999**********************98788999****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.3E-1544122IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-1347122IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.26351122IPR003340B3 DNA binding domain
CDDcd100171.44E-1252122No hitNo description
SMARTSM010191.3E-452130IPR003340B3 DNA binding domain
PfamPF023623.9E-1353122IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-15127221IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-16128221IPR015300DNA-binding pseudobarrel domain
CDDcd100172.30E-13130223No hitNo description
PfamPF023621.6E-13131220IPR003340B3 DNA binding domain
PROSITE profilePS5086311.448131226IPR003340B3 DNA binding domain
SMARTSM010192.9E-19131226IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.7E-11275372IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.065277375IPR003340B3 DNA binding domain
CDDcd100171.42E-6277371No hitNo description
SuperFamilySSF1019365.1E-13278372IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.4E-12278373IPR003340B3 DNA binding domain
PfamPF023623.3E-9281372IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MLFNVSACDI RDKPMPSNND INKIDQLERV KKVRKNSSQS EAGSSSSGNS SFVALVKASN  60
LKEDALYLPQ DCTSSNGLNK KCRKIFLTDG GDRSWEMDLK FDKNLDSFCI TRGWRHFCDE  120
NGKKLPNQER FVTVRLVPDC LRNKRLYLSR RFLKNNGLGE PKMVTLVGTD GTRILANLLR  180
ESTGRMSLGR GWVDFAKANR LKIGEYFTLE SIWENDSPIL SLYGTNTSKS DKRKRRENFP  240
VACEKEYVST EARNRNEPEK DKNTEEMINQ ASLSENRLVI TLVPEDVKAG MLRLPSHFMK  300
ANGIDKVGKI YMLGINEMEW WWGDLLTRDG IVSVGCGWRY FCESNGVKIG KSFTLECMYK  360
YDTRPVFKFC PKSGK
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT2G24696
AtGenExpressAT2G24696
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G24696.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G24696
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0072660.0AC007266.5 Arabidopsis thaliana chromosome 2 clone F27A10 map mi238, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001154532.10.0transcriptional factor B3 family protein
SwissprotF4IQL70.0REML2_ARATH; B3 domain-containing protein REM-like 2
TrEMBLD7LIB90.0D7LIB9_ARALL; Putative uncharacterized protein
STRINGAT2G24696.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]